SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KFD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KFD3
Domain Number 1 Region: 25-96
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000000034
Family Chaperone J-domain 0.0019
Further Details:      
 
Weak hits

Sequence:  A0A0L7KFD3
Domain Number - Region: 216-279
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 0.0876
Family V-type ATP synthase subunit C 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KFD3
Sequence length 321
Comment (tr|A0A0L7KFD3|A0A0L7KFD3_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB61795.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_03531 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRIHCFSFVLLYFLFVNNVNCLLKKVLHHFYCNNENCYDILGVNEKASLDEIKFSYFRLL
KKVEKNHDREKKKRIVKAFNVLVNKSTRKYYDYYLKYPNSFLNLVYLNMYIFYKLFKIIC
ILLLIGLLLCVFQYIHNKYELKRVIQKSSKNKAFKKEVQNRISSQHPGFMNYDIKKKKKI
EEQIEEEVVQEIVMINNQKTKKLLLADLIIVKLLFLPKQLWFYIIWNIKWVIKYNILNED
YDEHDKIYITRKYMNISMDKWNTLNPEEKKNYLKKELWMKAKQEEFLQEIKERDRLNKIS
SAKYKKQIRMKKKGLSFNYND
Download sequence
Identical sequences A0A024W500 A0A024X7P1 A0A0L1I922 A0A0L7KFD3 A0A2I0C0W8 Q8IHT4 W4IY68 W7F6C8 W7FTA9
PF11_0443 XP_001348112.1.26446 5833.PF11_0443-1 gi|124804789|ref|XP_001348112.1| gi|23496368|gb|AAN36025.1| PFHG_03531T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]