SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KG51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L7KG51
Domain Number - Region: 48-101
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.012
Family Glutamyl tRNA-reductase dimerization domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KG51
Sequence length 210
Comment (tr|A0A0L7KG51|A0A0L7KG51_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB62085.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_03838 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNFINFKIYIFFILFHTFILSNTNIPRTNNNKNNNQKNVTNDTTPLGTIKDIIALDYIRD
LLKHIELIKDEIIKDKLKKIKLLKNNKNLIKKIENLEKGLIATRLLCKNYIKNELKEIKI
IKDQIVNEKIQQYRGKKEKLIDTELNKLFLQEKMKKDKKKYEQYMKKQLQNTLLQKGILK
TNGIILKILQKINNLFIEITNDNPKVQLTS
Download sequence
Identical sequences A0A024VZ54 A0A024WZS8 A0A0L1IFE0 A0A0L7KG51 A0A0L7M3H9 A0A2I0C338 Q8IK46 W4I949 W4IWW7 W7F6Q1 W7FG93 W7J7S4
XP_001348935.1.26446 PFHG_03838T0 gi|124810583|ref|XP_001348935.1| gi|23497837|gb|AAN37374.1| PFDG_03388T0 PF14_0762 5833.PF14_0762-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]