SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7LZR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L7LZR1
Domain Number - Region: 87-124
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000127
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LZR1
Sequence length 282
Comment (tr|A0A0L7LZR1|A0A0L7LZR1_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB86072.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_01673 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKIGKKLKGFNEGIPKLNTNINDKIIKEKEENDSEERERQREKYKNEKEHELNEMIFEH
DDQQNIHEQYRKLYLENIKDSKIYIHDDLQYYLEKNNIPTLLVLLLYRILIEKPENIIKF
IIDQIYVFLFTKTETNKKKHALLKPLECTFQQSCEEKEKKTKKEQDENNMINSLDGDMNP
SFHESINDALQKNNNLIESINYESFIKQHFFGLDNILEVVDFLKIENTEEIYYNNLIHII
KNFQNPINNQILQRENVSYGQTISLNKALCLSETIYNNYFYN
Download sequence
Identical sequences A0A024V7A2 A0A024VQW7 A0A024WPK7 A0A0L7K9I8 A0A0L7LZR1 W4II67 W7ESP9 W7FYP5 W7JXR8
PFHG_01475T0 PFDG_01673T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]