SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7M7A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7M7A9
Domain Number 1 Region: 17-59
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000549
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7M7A9
Sequence length 61
Comment (tr|A0A0L7M7A9|A0A0L7M7A9_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB88465.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_02375 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDKDTEFEFTKIENINLDSYEIPKYFEEILSEFIATLIQHKPENVYLFSINYFEEKLNSS
K
Download sequence
Identical sequences A0A024VP36 A0A024W689 A0A024X5W1 A0A0L1I522 A0A0L7K987 A0A0L7M7A9 Q8IIW3 W4IGP6 W4IZY7 W7EZS8 W7FTJ4 W7K5F7
5833.PF11_0050-1 PF11_0050 gi|124803466|ref|XP_001347726.1| gi|23495976|gb|AAN35639.1| XP_001347726.1.26446 PFHG_01741T0 PFDG_02375T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]