SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7MNI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7MNI3
Domain Number 1 Region: 14-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000109
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7MNI3
Sequence length 192
Comment (tr|A0A0L7MNI3|A0A0L7MNI3_COMTE) Glucan biosynthesis protein {ECO:0000313|EMBL:KOC23400.1} KW=Complete proteome OX=285 OS=Comamonas testosteroni (Pseudomonas testosteroni). GN=GL58_06260 OC=Comamonadaceae; Comamonas.
Sequence
MSSIAQSWQRISAWYAQNTPKDTLVLADGASEAEIAELEAALGQRLPGDVRESLALHNGA
ANEAYLLYFGELLSTQRMLEVWQMYADMQKSEGWGLGPDYNPDYLQGPLRPVYWDALRIP
LTDNCGDGAMLDLAPAAGGHAGQIIEFDHEAGPKGVFAPSFSAWLALLADELEQGKHVYI
EDAGCVAPPGTW
Download sequence
Identical sequences A0A0L7MNI3
WP_053282929.1.77482 WP_053282929.1.95795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]