SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7QLH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7QLH6
Domain Number 1 Region: 8-119
Classification Level Classification E-value
Superfamily SRP19 4.32e-33
Family SRP19 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L7QLH6
Sequence length 149
Comment (tr|A0A0L7QLH6|A0A0L7QLH6_9HYME) Signal recognition particle 19 kDa protein {ECO:0000313|EMBL:KOC59477.1} KW=Complete proteome; Reference proteome OX=597456 OS=Habropoda laboriosa. GN=WH47_10623 OC=Apoidea; Apidae; Habropoda.
Sequence
MALAWNPSKKHSDRERWICIYPLYINSKKTLAEGRKLAKDKCVENPTHQEIRDVLVAAGF
NVAVENKLHPKERSKELLYRGRIRVQLKSDDGIALKSEFPTRDSVMSYLGTTIPRLKTRQ
GKQTSGEQSTQSSNLSTKKGKGKGKGRRG
Download sequence
Identical sequences A0A0L7QLH6
XP_017796321.1.86229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]