SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7QRT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7QRT7
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000000863
Family Preprotein translocase SecE subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7QRT7
Sequence length 66
Comment (tr|A0A0L7QRT7|A0A0L7QRT7_9HYME) Protein transport protein Sec61 subunit gamma {ECO:0000313|EMBL:KOC61226.1} KW=Complete proteome; Reference proteome OX=597456 OS=Habropoda laboriosa. GN=WH47_06712 OC=Apoidea; Apidae; Habropoda.
Sequence
MDQVKKLTEPGRQFAKDSIRLIKRCTKPDRKEFQKIAIATAIGFCIMGFIGFFVKLIHIP
INNIIV
Download sequence
Identical sequences A0A0L7QRT7
XP_006567439.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]