SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8G1L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8G1L0
Domain Number 1 Region: 229-273
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000889
Family Fibronectin type I module 0.046
Further Details:      
 
Domain Number 2 Region: 284-334
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000889
Family Fibronectin type I module 0.06
Further Details:      
 
Domain Number 3 Region: 67-113
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000157
Family Fibronectin type I module 0.025
Further Details:      
 
Domain Number 4 Region: 11-56
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000439
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 5 Region: 174-216
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000868
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 6 Region: 339-385
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family Fibronectin type I module 0.051
Further Details:      
 
Domain Number 7 Region: 123-168
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000188
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 8 Region: 396-436
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000068
Family Fibronectin type I module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8G1L0
Sequence length 442
Comment (tr|A0A0L8G1L0|A0A0L8G1L0_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF70907.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22002020mg OC=Octopus.
Sequence
ETTIQTDDTSVECRYQQKVYMFGDIFIAVDKCNKCSCKSKGKVECTKKKCPPSTTPETTL
KKIEIYFKCYYNGDVHVFGDVFIAVDKCNKCSCKSKGKVECTKKKCPPSTTPETTSKKDD
TSSKCYYHAEIHLFGDIFLAVDKCNKCSCKSKGKVECTKKKCPPSTTPETTTSSKCYYNG
KMYILGQIFVAVDKCNQCSCKFKGKVECTERKCSSTTAVGATLKNDTSSKCKYNGQVYIA
GQVFVAVDKCNQCSCKPKGEVDCTKKTCPSSVTPETTKQNNETSKTCSYNGQVYMFGQIF
MSSDKCNKCSCKSKEKVECSEKKCSLPITPATPVNETSVKCHYHGQMYVFGQIFTAVDKC
NNCSCESKGKVECTEKKCIPSTTPETSTQMKHNYFLCHYHGEVHVIGQTFTAGDKCNTCT
CKSKGTITCTERKCSQGKSQGN
Download sequence
Identical sequences A0A0L8G1L0
Ocbimv22002017m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]