SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8G238 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8G238
Domain Number 1 Region: 66-112
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000617
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 2 Region: 285-329
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000806
Family Fibronectin type I module 0.046
Further Details:      
 
Domain Number 3 Region: 122-169
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000126
Family Fibronectin type I module 0.025
Further Details:      
 
Domain Number 4 Region: 340-387
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000209
Family Fibronectin type I module 0.06
Further Details:      
 
Domain Number 5 Region: 11-56
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000429
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 6 Region: 230-272
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000753
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 7 Region: 179-224
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000199
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 8 Region: 398-438
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000659
Family Fibronectin type I module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8G238
Sequence length 444
Comment (tr|A0A0L8G238|A0A0L8G238_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF70909.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22002020mg OC=Octopus.
Sequence
ETTIQTDDTSVECRYQQKVYMFGDIFIAVDKCNKCSCKSKGKVECTKKKCPPSTTPETTP
KKIEIYFKCYYNGEIHLFGDVFIAVDDCNKCSCKSKGKVECTKKKCPPSTTPETTLKKIE
IYFKCYYNGDVHVFGDVFIAVDKCNKCSCKSKGKVECTKKKCPPSTTPETTSKKDDTSSK
CYYHAEIHLFGDIFLAVDKCNKCSCKSKGKVECTKKKCPPSTTPETTTSSKCYYNGKMYI
LGQIFVAVDKCNQCSCKFKGKVECTERKCSSTTAVGATLKNDTSSKCKYNGQVYIAGQVF
VAVDKCNQCSCKPKGEVDCTKKTCPSSVTPETTKQNNETSKTCSYNGQVYMFGQIFMSSD
KCNKCSCKSKEKVECSEKKCSLPITPETSTQMKHNYFLCHYHGEVHVIGQTFTAGDKCNT
CTCKSKGTITCTERKCSQGKSQGN
Download sequence
Identical sequences A0A0L8G238
Ocbimv22002015m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]