SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8G9Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8G9Q0
Domain Number 1 Region: 29-108
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000184
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 136-216
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000185
Family Extracellular domain of cell surface receptors 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8G9Q0
Sequence length 220
Comment (tr|A0A0L8G9Q0|A0A0L8G9Q0_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF73747.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22037359mg OC=Octopus.
Sequence
MKGAESHRLEHGKIIFPIMPKVDSLVLRYLPDNNITYIQRGIFENLPNLQKLFLHNSQIK
TYEDGAFLFLPSVNYFDLRGNKDMMCECHLPAIVNYTKKILKKNVYVLGDCLIDLGKVIR
IMKYTQCQNYSLFQRNLQCQTCSGMKCKDPEVTNCTADEPVCESKFSMNGATVKYEKSCS
TYRKCLEALRNNTFTCNKQTSNISCVTCCTGNLCNKNDLI
Download sequence
Identical sequences A0A0L8G9Q0
Ocbimv22037359m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]