SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8GF11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8GF11
Domain Number 1 Region: 269-388,418-470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.49e-24
Family Nucleotide and nucleoside kinases 0.00071
Further Details:      
 
Domain Number 2 Region: 60-178,209-257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.06e-17
Family Nucleotide and nucleoside kinases 0.01
Further Details:      
 
Domain Number 3 Region: 13-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8GF11
Sequence length 480
Comment (tr|A0A0L8GF11|A0A0L8GF11_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF75591.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22034504mg OC=Octopus.
Sequence
MDATMRPMSLPPEFTNYAEEHQLFELMKFLIEQLLLKKPEDPIEFLIDILLLRLKEVIKV
IIFGPPASGKTTLAKMICEKLDLVYLCEDRLLIKTSSNLLNEAREHQAANNPIPADLWLR
MLWEETERGKCKANGWVFEGVFSTREAIAKMQQQGVHPTHCIFLVALESILVERAVGKRI
DRRNGDIYHMTFDWPLSADVKANLVEAPGCTESEIIQKYLAYEYALPGLIQRFKKNYKTI
NADQPKGDILSKVLCFLSHKPQSMAPHTPRVILLGAFGSGKKTQAHLLAKRFQLVNVSCS
QLIKQAVTNETSTGQIAKSYLDQGLSLPDGIVITIVKERLTQLDCMTCGWVLHGFPRNVY
QAQDLDDAGLFPTRVFFLDVSLDSILERLTPLRTDLVTGQQHHLHFNPPQTLAMMDHLRA
NPRHMEKTVTEKVSRFHAQEDELSIYYTEKASHLNADQDYYTVFETIMSMIINPVAVNFD
Download sequence
Identical sequences A0A0L8GF11
XP_014781615.1.24776 Ocbimv22034504m.p Ocbimv22034505m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]