SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8GKL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8GKL7
Domain Number 1 Region: 53-126
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000036
Family Ovomucoid domain III-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8GKL7
Sequence length 139
Comment (tr|A0A0L8GKL7|A0A0L8GKL7_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF77546.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22031987mg OC=Octopus.
Sequence
MYQDFKLSLRKFSFEVVTFSSLITLILLCLFSLCNFQPANACYVYPADMKDPCEQKKCSF
GAECVPSLDGFSYRCQCPNRCNTYGDNIGSTPVCGNDGVDYSNMCEMRKAACQEMKDIRV
KYYGKCEMFEEKKNGEHAS
Download sequence
Identical sequences A0A0L8GKL7
Ocbimv22031987m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]