SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8H374 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8H374
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.98e-26
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 184-229
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000445
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8H374
Sequence length 232
Comment (tr|A0A0L8H374|A0A0L8H374_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF83647.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22023442mg OC=Octopus.
Sequence
MLATKENKPDIIKALIEAKCDCYISARSGNAAIHIAARKDLLQCFQILLDNGVDINTRDP
EQNTPLIISGHTECIEDMLEAGLDLNILDNQYRTPLWYALNSGRFEAVESLLKYTSHVAS
YSCPTQAPETSCPVKLAFLKGAKKVIKQFILIGFDKDHIRYYIQNSDDVTADWTTVDQND
WFSFIQQPLTLLQISRIWIRHYLGRLFYLNVSKLPLPKSFQDFLLFSDFKNI
Download sequence
Identical sequences A0A0L8H374
Ocbimv22023443m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]