SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8H642 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8H642
Domain Number 1 Region: 230-273
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 2 Region: 650-692
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000115
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number 3 Region: 700-741
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000146
Family Fibronectin type I module 0.06
Further Details:      
 
Domain Number 4 Region: 336-379
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000335
Family Fibronectin type I module 0.071
Further Details:      
 
Domain Number 5 Region: 171-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000889
Family Fibronectin type I module 0.029
Further Details:      
 
Domain Number 6 Region: 603-642
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000157
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number 7 Region: 548-599
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000188
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 8 Region: 284-326
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000377
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 9 Region: 394-439
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000523
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 10 Region: 62-110
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000816
Family VWC domain 0.025
Further Details:      
 
Domain Number 11 Region: 798-839
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000136
Family Fibronectin type I module 0.066
Further Details:      
 
Domain Number 12 Region: 749-790
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family Fibronectin type I module 0.056
Further Details:      
 
Domain Number 13 Region: 494-536
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000366
Family Fibronectin type I module 0.038
Further Details:      
 
Domain Number 14 Region: 114-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000398
Family Fibronectin type I module 0.067
Further Details:      
 
Domain Number 15 Region: 847-888
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000408
Family VWC domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8H642
Sequence length 894
Comment (tr|A0A0L8H642|A0A0L8H642_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF84667.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22021630mg OC=Octopus.
Sequence
MIVHNSLPKKFCTYKGHEYRIAQVFLGDDGCSKCSCPASGEVTCVKQTCVIKKEVVTTTS
APFCVYNGFKYNKNEEFAGIDGCSKCSCTESGVVACIKQMCSELDNNPAPTPQTVCIYNE
HTYQVEEEFEGADGCSKCQCSGSGLVTCVKQVCSKSRNGEVITVEKGDTSAVCRYHGKVY
IFGQTFISIDKCNQCSCRSKGKVECTQKICSSQGEAHLLEITTEKFDLFAICHYNGHVYI
FGQTFPSVDKCNQCSCKSKGVITCSKRTCPPPRMQATTKIDIKVECRYNGKIFVFGQTFI
AIDKCNHCICKFKGKISCTKEKCQETTTQKTRESSSVCRYNGQVYIIGQIFVAIDKCNRC
SCKPEGIIICTKQTCSSPQKEAYLTESGERKLKTFAVCRYNGRTYVFGETFTAEDKCNEC
SCKRKGAVICTKKPVCSPSISEISVKCHYNGKTYNIGVTFDAADKCNKCTCKAKGNVDCT
TNICVFSEKHEISVKCKYGTKIYIVGETFPATDNCNKCSCKSKGIVECTKSICLSTGSQE
TTTHKIDIFAVCHYYGHIYIFGQTFKSVDRCNQCSCQSKGNTVCTKKKCTSMTTPEAPIT
LIACHYNGKVYKFGQTFAAIDKCNQCACMTKGSVMCTKKICFSKTIQVKTECYYNGKVYI
IGQTFIAIDKCNECTCKPAGAVMCTEEICPLSKTTVTKIECHYNGKVYIIGQTFIAIDKC
NQCTCRYTGSVICTEKICPPSETTVTKIECRYYGKVYVIGQTFIAIDKCNQCTCKYTGAV
VCTEKICSISKTSVTKVECHYYGKVYVIGQTFIAIDNCNQCICKFTGDILCTEKTCPLSK
TTVTKIECRYYGKVYVTGQTFIAIDNCNQCICKFTGDILCTEKTCPLSKTTGNN
Download sequence
Identical sequences A0A0L8H642
Ocbimv22021626m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]