SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8I2U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8I2U5
Domain Number 1 Region: 11-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8I2U5
Sequence length 93
Comment (tr|A0A0L8I2U5|A0A0L8I2U5_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF95375.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22038705mg OC=Octopus.
Sequence
MAVVPLRNVPAELKQYLVHHRIPDICEALMTALAMMCPEDPYLFIINKLLHIKEQGLQSV
RWDMFLDETIKSRRALYKCRFEFSFEEDEDENV
Download sequence
Identical sequences A0A0L8I2U5
Ocbimv22038705m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]