SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8K9N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8K9N9
Domain Number 1 Region: 8-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000101
Family SMI1/KNR4-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8K9N9
Sequence length 192
Comment (tr|A0A0L8K9N9|A0A0L8K9N9_STRVR) Uncharacterized protein {ECO:0000313|EMBL:KOG22687.1} KW=Complete proteome OX=1938 OS=Streptomyces viridochromogenes. GN=ADK34_20755 OC=Streptomyces.
Sequence
MMDRVESLTDCISLIRGEGGDDVDWVAVQEFYGVEFPADYKKFVSRFGGGTIDGRVGIMV
PIAVDDEMVRKVYRLPESIRVDPGMSGWVDARNLGLERDILVWGDTDSADLLGWVTNESD
PDSWPIVVYSRVNAAWSVYECFMSEFIFRLLVGDFGECPISDTSLMRSTTAEFLRDREEE
RLLDMGIYPWDD
Download sequence
Identical sequences A0A0L8K9N9
WP_033201850.1.28093 WP_033201850.1.63210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]