SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8KN89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8KN89
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000275
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8KN89
Sequence length 147
Comment (tr|A0A0L8KN89|A0A0L8KN89_STRVR) Uncharacterized protein {ECO:0000313|EMBL:KOG27418.1} KW=Complete proteome OX=1938 OS=Streptomyces viridochromogenes. GN=ADK34_15625 OC=Streptomyces.
Sequence
MALPTDYKAFLDSYGPGSFDDLFWLVRPVEGTQVELEQIWSMSGRPHLDDPERTPFPFHP
HPGGLIQWGGGEDGTTYYFLPEEEDPDDWRVVVETEEGEWHEAPGPFTEFLLNCVEGPHR
PPFLGRYRPGPTLRYHPESEDGPDHPW
Download sequence
Identical sequences A0A0L8KN89
WP_033207305.1.28093 WP_033207305.1.63210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]