SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8LZV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8LZV3
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily MbtH-like 8.63e-30
Family MbtH-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8LZV3
Sequence length 69
Comment (tr|A0A0L8LZV3|A0A0L8LZV3_9ACTN) Protein mbtH {ECO:0000313|EMBL:KOG43619.1} KW=Complete proteome; Reference proteome OX=67356 OS=Streptomyces resistomycificus. GN=ADK37_00315 OC=Streptomyces.
Sequence
MTTNPFEDPQGSFLVLVNDENQHSLWPSFAEVPAGWRSVFGKATREACLTYVESHWTDLR
PASLVDGRG
Download sequence
Identical sequences A0A0L8LZV3
WP_030039857.1.35309 WP_030039857.1.36768 WP_030039857.1.36907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]