SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8M5R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8M5R4
Domain Number 1 Region: 36-162
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000549
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8M5R4
Sequence length 202
Comment (tr|A0A0L8M5R4|A0A0L8M5R4_STRVG) Uncharacterized protein {ECO:0000313|EMBL:KOG45726.1} KW=Complete proteome OX=1961 OS=Streptomyces virginiae. GN=ADK75_30180 OC=Streptomyces.
Sequence
MTPAPDPAHELATKRQVTEVWQRISSWLAQHAPASQAALLPGLTDDAIDLFECDLGVRIP
VELRALWHMCGGDSGTNRGGCMPGNTALMPREQIVDFYRQQINSQSSGWGVDWIPVISNR
VGDCAIGLYLDTGTGLLGQWSRYGDIELDEADTVATYLEEVADMLEYPALAARDLPGLVG
GRLVWGDSLDPADDEAWRPLAG
Download sequence
Identical sequences A0A0L8M5R4
WP_053176070.1.12662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]