SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8M8N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8M8N6
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000432
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8M8N6
Sequence length 381
Comment (tr|A0A0L8M8N6|A0A0L8M8N6_STRVG) Uncharacterized protein {ECO:0000313|EMBL:KOG46756.1} KW=Complete proteome OX=1961 OS=Streptomyces virginiae. GN=ADK75_25760 OC=Streptomyces.
Sequence
MTSDLVQDSWTRIDAWLREHAPRAFATLRPPAGGEEIAAAQQELWVTFPPDLVASLLRHN
GALEGPEAFRFSTGDRLLGVSGILGDTGFMRGIDQGLDGGTEGYWLHDYVKFGSYDVTSD
GLLMDCRTGRDSFGVIGRFFDETGASFGQADSLGEYLAELAGTLERGQDAGVVTFNGRLF
WEARPPARPQYSADEPLPAPDELLPELDLSYSPTDLLHVSHLDGHEELGALIAVLPYEQV
VDAARKQLRRLAVETGLNNYPEVKTALDAWECGVALPQPDQTGPLALRLRAVLAQADTGR
DHTRRWAAEKIALGIWGSPYRSVCESAETRSHFTLDWRADLHADLGNQPLPPIPDDRFWG
ALRNPAIDSSWYAAQYSQDQE
Download sequence
Identical sequences A0A0L8M8N6
WP_053174375.1.12662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]