SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8MF47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8MF47
Domain Number 1 Region: 170-308
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000759
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8MF47
Sequence length 335
Comment (tr|A0A0L8MF47|A0A0L8MF47_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KOG49007.1} KW=Complete proteome; Reference proteome OX=249567 OS=Streptomyces decoyicus. GN=ADK74_06475 OC=Streptomyces.
Sequence
MTTGRQGLGALPGPRAAGDAAPPNSAYAGQVVHFPDPVRATRYPAGVRMDEHGFPEFSPY
ARAAAEIAEPPEGFGVDELRLTDYVSANAALHAQGHELWIDVPPVATPHGWTWHHVAGTR
RMELIPVEVKALLRHHGGLATAAVAHDRRGTRPLQETRPVHFGLPHRDLSVGEEQVAQAE
EVLGYRLPGAYRSFLKAAGGCAPVGAALDAELGLLVDQPFFTVRDDAAVNDLVYVNKCLR
DHFTKDYLGVVFVQGGVVAVKVRGEALGSVWFCPYDDARDQDGWTVQERVERLLLPCGAD
FDEFLQRLAGNPPELDTVANLMVDGGFAYAVAVGG
Download sequence
Identical sequences A0A0L8MF47
WP_048829560.1.53724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]