SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8MQJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8MQJ5
Domain Number 1 Region: 66-216
Classification Level Classification E-value
Superfamily Sortase 0.0000000000000114
Family Sortase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8MQJ5
Sequence length 218
Comment (tr|A0A0L8MQJ5|A0A0L8MQJ5_STRVG) Peptidase C60 {ECO:0000313|EMBL:KOG52610.1} KW=Complete proteome OX=1961 OS=Streptomyces virginiae. GN=ADK75_15480 OC=Streptomyces.
Sequence
MGGDFGGARRRLPRTPTARHGGLVALAACVGIWLVTSGSREPVGPPLPSPAESLTAAGAV
GPGIAPLPGSPPGRIRIPSIRVDAPLTGLGLDAHGSLEVPPPDRRDLAGWYRDGITPGAT
GTAVIAGHVDDAAGPGVFYHLGALRRGASIEVPRADGRTAVFTVHAVEVYDAKAFPDTRV
YGPSARAELRVITCGGGFSPRTGYRGNVVVFAHLTGTY
Download sequence
Identical sequences A0A0L8MQJ5 A0A0M8SBN9 A0A1V0R4T3
WP_051778972.1.12662 WP_051778972.1.24860 WP_051778972.1.72023 WP_051778972.1.9715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]