SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8N043 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8N043
Domain Number 1 Region: 111-261
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000183
Family SMI1/KNR4-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8N043
Sequence length 293
Comment (tr|A0A0L8N043|A0A0L8N043_STRVG) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KOG56042.1} KW=Complete proteome OX=1961 OS=Streptomyces virginiae. GN=ADK75_08870 OC=Streptomyces.
Sequence
MDGNGHPDFSAYARAAVEIAEPPEGFGVDELRLTDYVSANAAMKAAGHELWDTVGPVATP
HGWTWHHVAGSRRMELVPVEVKALLRHHAGLTTAPVDHEKRGTRPLQEVRPAHLGLPKSV
VSVAEEQVQGVEEDLGYRLPEAYRSFLKAAGGCAPVGAGLDVDLGVLVDQPFFTVREEAA
VNDLVYVNKCLRDHLTKDYLCVAFAQGGLIALKVKGEGIGSVWFSPYDDARDRDGWSVQE
RVERLLLPCGADFDAFLERLAGNPPELETVAGLMVDGGFARSVPVSGSAPVEG
Download sequence
Identical sequences A0A0L8N043 A0A0M9Y2D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]