SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8NI03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8NI03
Domain Number 1 Region: 171-308
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000222
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8NI03
Sequence length 335
Comment (tr|A0A0L8NI03|A0A0L8NI03_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KOG62242.1} KW=Complete proteome OX=35619 OS=Streptomyces griseoflavus. GN=ADK76_13405 OC=Streptomyces.
Sequence
MTSGRHGLGAPPGPQAAGHAAPPNSAYAGQVVHFPDPVRAARYPRGVPVDGRGFPDFSSY
ARAAAEIAEPPEGFGVDELRLTDYVSANVALHAEGHELWEDVPPVATPHGWTWHHVAGTR
RMELVPVDVKALLRHHGGLATASVDHGRRGTRPLQDTRPVHFGLPHRELSVAEEQVQQAE
ESLGYRLPGAYRAFLKAAGGCAPVGVGLYADLGLLVDQPFFTVRDEAAMNDLVYVNKCLR
DHFTKDYLGVGFVQGGVIAVKVRGDAPGSVWFCAYDDARDRDGRPVQERAERLLLPCGAD
FDDFLQQLAGSPPELETVANLMVDGGFARAVPVEG
Download sequence
Identical sequences A0A0L8NI03 A0A0M8RM39 A0A0X7JE16
WP_030593727.1.2635 WP_030593727.1.33761 WP_030593727.1.53075 WP_030593727.1.56860 WP_030593727.1.99707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]