SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8P4Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8P4Y7
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily MbtH-like 5.36e-26
Family MbtH-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8P4Y7
Sequence length 65
Comment (tr|A0A0L8P4Y7|A0A0L8P4Y7_STRAT) Antibiotic synthesis protein MbtH {ECO:0000313|EMBL:KOG70093.1} KW=Complete proteome OX=1890 OS=Streptomyces antibioticus. GN=ADK77_12765 OC=Streptomyces.
Sequence
MQQHTSQQWLVVVNDEEQYSVWWADRSVPEGWRAVGVSGPKEECLDYIERTWTDMRPLSL
RNAVA
Download sequence
Identical sequences A0A0J8AD32 A0A0L8P4Y7 A0A0M8W7U2 A0A0S2PG17 A0A117Q9K2
WP_030644613.1.10365 WP_030644613.1.21862 WP_030644613.1.24691 WP_030644613.1.28171 WP_030644613.1.28949 WP_030644613.1.35348 WP_030644613.1.39672 WP_030644613.1.56730 WP_030644613.1.66388 WP_030644613.1.88765 WP_030644613.1.97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]