SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8P855 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L8P855
Domain Number - Region: 25-85
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0706
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8P855
Sequence length 263
Comment (tr|A0A0L8P855|A0A0L8P855_KITAU) Uncharacterized protein {ECO:0000313|EMBL:KOG71169.1} KW=Complete proteome OX=1894 OS=Kitasatospora aureofaciens (Streptomyces aureofaciens). GN=ADK78_25820 OC=Kitasatospora.
Sequence
MTERRERLDPARAFGAAATSRAAVWEFVEAFAESWMAPLSPADGIPPSEVRRAEERLGYP
LPAPLSEAYALFGRRADLVAVHNPLLAPEELLLDPSGELLVFRSENQGCAGWGVPLDRLG
DDDPPVGLFSDHLPGVAWKPYLDRLSRAFAELVLSEAVMARRYGPCGRECPAPAEVIAAV
EATYQPIALPPCPAWYHPEGEPTRWFSAPGKLLCLEPDPVEPVLVVVGQSETEVLEILAA
VPGAWSAVEPVPYEYEEDAPPFG
Download sequence
Identical sequences A0A0L8P855 A0A0X3RVZ5 L8EY71
WP_003980048.1.100537 WP_003980048.1.10659 WP_003980048.1.11843 WP_003980048.1.16484 WP_003980048.1.16806 WP_003980048.1.16854 WP_003980048.1.19068 WP_003980048.1.23387 WP_003980048.1.27877 WP_003980048.1.29667 WP_003980048.1.40819 WP_003980048.1.44064 WP_003980048.1.46139 WP_003980048.1.47700 WP_003980048.1.55007 WP_003980048.1.64888 WP_003980048.1.65676 WP_003980048.1.69365 WP_003980048.1.72292 WP_003980048.1.75076 WP_003980048.1.7965 WP_003980048.1.86519 WP_003980048.1.86803 WP_003980048.1.87188 WP_003980048.1.92884 WP_003980048.1.9496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]