SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8RDH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8RDH2
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 6.41e-16
Family Proteinase A inhibitor IA3 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8RDH2
Sequence length 67
Comment (tr|A0A0L8RDH2|A0A0L8RDH2_SACEU) PAI3-like protein {ECO:0000313|EMBL:KOG97504.1} KW=Complete proteome OX=1080349 OS=Saccharomyces eubayanus (Yeast). GN=DI49_4258 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNTDQQKVSEIFQSSKEKLQGDAKVVSDAFKEMANKDKNSDSSGDSSHKPDYQEQYNKLK
GAVKREE
Download sequence
Identical sequences A0A0L8RDH2
XP_018220222.1.77003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]