SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8RJ09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8RJ09
Domain Number 1 Region: 2-56
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 3.66e-21
Family Nucleolar RNA-binding protein Nop10-like 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8RJ09
Sequence length 58
Comment (tr|A0A0L8RJ09|A0A0L8RJ09_SACEU) NOP10-like protein {ECO:0000313|EMBL:KOG99136.1} KW=Complete proteome OX=1080349 OS=Saccharomyces eubayanus (Yeast). GN=DI49_2477 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MHLMYTLGPDGKRIYTLKKSTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Download sequence
Identical sequences A0A0L8RJ09
XP_018221854.1.77003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]