SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8SH63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L8SH63
Domain Number - Region: 2-118
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000326
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8SH63
Sequence length 124
Comment (tr|A0A0L8SH63|A0A0L8SH63_VIBPH) Uncharacterized protein {ECO:0000313|EMBL:KKC79683.1} KW=Complete proteome OX=670 OS=Vibrio parahaemolyticus. GN=WR32_00005 OC=Vibrionaceae; Vibrio.
Sequence
MILPSYYKNWLDSIDTGVEVSYRGSEFYLLSERELIDEITIDKNTVKAFNQLSAFIKTQL
EMSGSSPLTIEQCNTCITIGQDNGNPIFIDSTRDLELFCYYLDGGYIEAKGGNLLSLVIE
AKNT
Download sequence
Identical sequences A0A0F6LID8 A0A0L8SH63 Z2E2Y2
WP_005483170.1.20587 WP_005483170.1.21130 WP_005483170.1.56068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]