SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L9TVT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L9TVT4
Domain Number 1 Region: 17-61
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000106
Family B-box zinc-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L9TVT4
Sequence length 206
Comment (tr|A0A0L9TVT4|A0A0L9TVT4_PHAAN) Uncharacterized protein {ECO:0000313|EMBL:KOM34591.1} KW=Complete proteome; Reference proteome OX=3914 OS=Phaseolus angularis (Azuki bean) (Vigna angularis). GN=LR48_Vigan02g074100 OC=Phaseoleae; Vigna.
Sequence
MVVPPWFEPLLTTSFFNVCRVHGDAARSECNMFCLDCNEDAFCFYCRSSRHKDHRVIQIR
RSSYHDVVRVSEIQKVLDISGVQTYVINSARVLFLNERPQPKSGKGVAHICEICGRSLLD
PFRFCSLGCKLVGIKRNGDARFGGLDSKNETATMEGMSRRLVSSRYHQEEELREGSQQDM
YPATPSPPASNARRRKGIPHRAPFAS
Download sequence
Identical sequences A0A0L9TVT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]