SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0BT62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0BT62
Domain Number 1 Region: 94-181
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.83e-28
Family TATA-box binding protein (TBP), C-terminal domain 0.0000559
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.93e-27
Family TATA-box binding protein (TBP), C-terminal domain 0.0000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M0BT62
Sequence length 186
Comment (tr|A0A0M0BT62|A0A0M0BT62_9ARCH) TATA-box factor {ECO:0000256|HAMAP-Rule:MF_00408} KW=Complete proteome; Reference proteome OX=1685125 OS=miscellaneous Crenarchaeota group-1 archaeon SG8-32-3. GN=AC478_02690 OC=Archaea; Candidatus Bathyarchaeota; MCG-1.
Sequence
MPKVKATISIENVVASATLNQKVDLNAVVKGYPGVEYRPEQFPGLVFRLKRPKTATLIFN
SGKMVCTGAKSEKEARRAVMKVIKELKKGGIIIISKPELKIQNIVASASLGGMIDLEKAA
YTLEKTMYEPEQFPGLIYRMREPKVVILLFASGKLVCTGAKKEQDVYDAVQKLHTLLEEK
KLIFYD
Download sequence
Identical sequences A0A0M0BT62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]