SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0G0W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0G0W5
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000034
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0G0W5
Sequence length 193
Comment (tr|A0A0M0G0W5|A0A0M0G0W5_9BACI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KON83252.1} KW=Complete proteome; Reference proteome OX=189381 OS=Bacillus marisflavi. GN=AF331_20750 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MELINHFIEGLHEHLLPEELEELQKSHGASPEDLEELRRLYPDCPESLLSLLKNIDGTFW
RQYGEEKIAVCILGSDVEDGRYPYYLLSTQQMIDSSKEEVDTSYLSEYEEDDVDSRINQD
GLYPGTYIHFSDCMNNGGTSSLFIDFNPTDQGVSGQIVCFLHDPDEFKVIADSFDEYVQG
LIDGGFVFLEEEE
Download sequence
Identical sequences A0A0M0G0W5
WP_053429871.1.52468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]