SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0J6V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0J6V6
Domain Number 1 Region: 92-144,201-237,595-634
Classification Level Classification E-value
Superfamily TPR-like 0.00000159
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 2 Region: 21-59
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000549
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M0J6V6
Sequence length 964
Comment (tr|A0A0M0J6V6|A0A0M0J6V6_9EUKA) Tpr domain protein {ECO:0000313|EMBL:KOO22344.1} KW=Complete proteome; Reference proteome OX=1460289 OS=Chrysochromulina sp. CCMP291. GN=Ctob_000728 OC=Chrysochromulina.
Sequence
MGGEASAHDSNTRKSIESMPADARAYLSAHNVEAAIKEAINRVLASRPADPIRAIAEMLN
PDLPPLDGYAAKLGAYHQPVSTSSAVAQRWFDRGWVWLAGFHREEAAFCFSSAIVADADC
AMGHWGLALAHGPDYNFSAQSGYFAVAAQPEGYPSLNVAVKAIQTALALLDGGKPCTARE
RALIEALATRYEYPPLDTTPQLQERYMAAMAQVADAYPRDADVQAIYAEACMCLAPWDLY
TKNAGVATPNWYSADKKLKPIGLRAKDAIDRGLGACLEHVWLCHLKIHLNEMGPVSAFDW
RAAEVVRRGDATGAGHLVHMPTHLDIQVGNYEQAMRCNVLGYKADLALLARSPERFSIYT
GYLVHNLEFCVWAAMYAGNQATAREAAAEIDKLFTEARLRSHPMLATFFEAYAAVPLMVL
VRFGCWEEVLAMPLPTDPSLYVTKTLFSHFARGLAHAIRFGDRKHHNVDLTQMAAIAERV
LEGELLYRAAEISARQIASLLEDRANGYSDDDLKQAGYSARVFLGARVPLEEARLAGFDE
AELRAAGYFGVNHSEAAEEPSFEDAFGALEGGIGLFDALPYDEPHGWLMSVRQTLGALLT
EQGLYDRALKVYEEDLQLFPDNPWALAGMRNCLRSRVGAGAVSRGATSNPRLAAVEEKLR
NALKTADVPIEGDVDLSTAENLKVRHHLKSDESVRAALHAWWAAVKANGLLTEDAAEPVL
RREGYEIIFLRFHKLLLDTWNYDEAKATVAEDWIEDLGDSERSGGMPQEVFFASLFELAD
LWTPIIDAAVYAEFLRRLLASCFEAGGKLCSLDSVTFDPALTSDKSERKSRKSKSRRAKR
HAQAVERQKAATRIQAHGRRKFGARKVEKRRKAAKLITARARAGIQGRRLLRLLSDAEVP
LLPLNKAGEVALTTTPVPTTARAGSSNIARPRASILIGRSVEASSFTAISAVFTAISAVE
RALE
Download sequence
Identical sequences A0A0M0J6V6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]