SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0KUI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0KUI2
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000353
Family SMI1/KNR4-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0KUI2
Sequence length 73
Comment (tr|A0A0M0KUI2|A0A0M0KUI2_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KOO42454.1} KW=Complete proteome OX=86667 OS=Jeotgalibacillus marinus. GN=AMC98_12185 OC=Jeotgalibacillus.
Sequence
MILGYDSHGAEVVEQTKEYRTFYKLIPGLVVIEYIDEYSYCLDTNKMVDGEYPVILWDNH
EGYGYTAVNNFLE
Download sequence
Identical sequences A0A0M0KUI2 A0A136GEV5 G4NW71
WP_014112745.1.83369 WP_014112745.1.93618 WP_014112745.1.95507 gi|350264736|ref|YP_004876043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]