SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0KZU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0KZU6
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000589
Family SMI1/KNR4-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M0KZU6
Sequence length 434
Comment (tr|A0A0M0KZU6|A0A0M0KZU6_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KOO44350.1} KW=Complete proteome; Reference proteome OX=284581 OS=Bacillus koreensis. GN=AMD01_13840 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKHLVNQWENIVQLVQNIGGEGYLYVDSVATEDEIVMTERKLDVKLPLSLKEALLGVSKA
VDVCWEFPDELIVPKPYKDNSFGKLQWNLHELEVLCDERGQKRLLIHHVGNGDLITIDVA
DDQPDGEVYYWYEDESTEYLLAKNVAHFLNNLTTLCLIGLEVEQVELFLSSEGLCADNPL
ALKWIKWFWSLGKKPVIDYSTTGDILRLITHLGEIRPKQMMHLTQMDRSEVKKELLTSSL
LENGWHRALLLGELFGSEIREWVLSLWEGVDENLLKERSYLTAKCLPIHIGLPLVIKFVE
GQHMTGYEAFHHLSYFRANDVIQWMTNYATLPFEGWDKLFAASGPTWEDLTQWLTSDEKR
HMFIAINAIGALVSFRERICFADRLAYGEKPFTIRNLPNSLQVAKFFEEFKQTGRGRNRY
HYIDAFLHLLTSMR
Download sequence
Identical sequences A0A0M0KZU6
WP_053402009.1.6789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]