SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0MDT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M0MDT3
Domain Number - Region: 78-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0706
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0MDT3
Sequence length 149
Comment (tr|A0A0M0MDT3|A0A0M0MDT3_BACTU) Uncharacterized protein {ECO:0000313|EMBL:OFD10129.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=B4918_08625 OC=Bacillus cereus group.
Sequence
MRLEYRLNDETKGYPALWNYANISNSEIIARMTCEYFIKEKNTYVVTATSVDPDGTAVIY
IQKEVFANDPSDPTYSHIGFEIRELSETSSSLVDSQDVWNYEEILPSLHSDIIYIQRDGM
SMEFSLDSREIDEDRKCYIYYGNFTGESR
Download sequence
Identical sequences A0A0F6JCY9 A0A0M0MDT3 A0A0Q9FZU4 A0A0Q9GZX3 A0A135X1B1 A0A160GXG1 A0A160L8Q4 A0A1I4AJX6 A0A1M7KK29 A0A242X7N6 A0A242Y4V1 A0A243B2R7 A0A243FS24 A0A243JJP4 A0A243MIW7 A0A2A9HYW3 A0A2B5VJN3 A0A2H3QE91 A0A2I0R9P9 B5URP5 B7IQ36 C2V9P5 C3DHS4 G9QBC5 J3ZXR4 J7WGC8 J8FVJ5 J8RH32 J9BJF3 K0FQG6 M1PHY2 R8C720 R8IH66 R8M0X4 R8S9Y9 R8YK72 S3IAY7 V5M763
gi|452197900|ref|YP_007477981.1| gi|402561334|ref|YP_006604058.1| gi|384185582|ref|YP_005571478.1| gi|218896606|ref|YP_002445017.1| gi|558680038|ref|YP_008818167.1| gi|434374614|ref|YP_006609258.1| 405531.BCG9842_B3708 gi|410673875|ref|YP_006926246.1| WP_001235522.1.100497 WP_001235522.1.100771 WP_001235522.1.101224 WP_001235522.1.101838 WP_001235522.1.11380 WP_001235522.1.11442 WP_001235522.1.11521 WP_001235522.1.12935 WP_001235522.1.13113 WP_001235522.1.13269 WP_001235522.1.13424 WP_001235522.1.14084 WP_001235522.1.17374 WP_001235522.1.22084 WP_001235522.1.23245 WP_001235522.1.23360 WP_001235522.1.2407 WP_001235522.1.24792 WP_001235522.1.24992 WP_001235522.1.26459 WP_001235522.1.27446 WP_001235522.1.27931 WP_001235522.1.28599 WP_001235522.1.31221 WP_001235522.1.3196 WP_001235522.1.3249 WP_001235522.1.33790 WP_001235522.1.34061 WP_001235522.1.34537 WP_001235522.1.3546 WP_001235522.1.35769 WP_001235522.1.36279 WP_001235522.1.37661 WP_001235522.1.38325 WP_001235522.1.3925 WP_001235522.1.40818 WP_001235522.1.41729 WP_001235522.1.42182 WP_001235522.1.42747 WP_001235522.1.42941 WP_001235522.1.43442 WP_001235522.1.4355 WP_001235522.1.44348 WP_001235522.1.44428 WP_001235522.1.4453 WP_001235522.1.45720 WP_001235522.1.47000 WP_001235522.1.474 WP_001235522.1.47437 WP_001235522.1.48759 WP_001235522.1.499 WP_001235522.1.50042 WP_001235522.1.52284 WP_001235522.1.54419 WP_001235522.1.55893 WP_001235522.1.57561 WP_001235522.1.5841 WP_001235522.1.58712 WP_001235522.1.5895 WP_001235522.1.59384 WP_001235522.1.60012 WP_001235522.1.60526 WP_001235522.1.61799 WP_001235522.1.62277 WP_001235522.1.6241 WP_001235522.1.64421 WP_001235522.1.66535 WP_001235522.1.69347 WP_001235522.1.70209 WP_001235522.1.70667 WP_001235522.1.71652 WP_001235522.1.72752 WP_001235522.1.73638 WP_001235522.1.75358 WP_001235522.1.75942 WP_001235522.1.77402 WP_001235522.1.80622 WP_001235522.1.81570 WP_001235522.1.83666 WP_001235522.1.84323 WP_001235522.1.84541 WP_001235522.1.84775 WP_001235522.1.8577 WP_001235522.1.86763 WP_001235522.1.87649 WP_001235522.1.87705 WP_001235522.1.89145 WP_001235522.1.89698 WP_001235522.1.90452 WP_001235522.1.91020 WP_001235522.1.91367 WP_001235522.1.92555 WP_001235522.1.93904 WP_001235522.1.94270 WP_001235522.1.96272 WP_001235522.1.9703 WP_001235522.1.97821 WP_001235522.1.97830 WP_001235522.1.98315 gi|407704064|ref|YP_006827649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]