SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0MI31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0MI31
Domain Number 1 Region: 50-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000667
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M0MI31
Sequence length 124
Comment (tr|A0A0M0MI31|A0A0M0MI31_BACTU) Uncharacterized protein {ECO:0000313|EMBL:OFD04324.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=BTGOE7_43270 OC=Bacillus cereus group.
Sequence
MINHNKIKQLLEYVDRAEDNEIELEYESEPMTIELFNSEEIEEGQLGYSFDEEGQSLTGN
EEGDWKEGWIVIGIDSYLGDPIFVDSNDEKCPVYTALHGEGDWEIECIAERIEDVIEKVK
GSVE
Download sequence
Identical sequences A0A0M0MI31 A0A1D3PQ16 A0A2B5AAR4 C2VIT8 C2X3Q7
gi|557621723|ref|YP_008782854.1| WP_000607087.1.100771 WP_000607087.1.13424 WP_000607087.1.14084 WP_000607087.1.2407 WP_000607087.1.24969 WP_000607087.1.24992 WP_000607087.1.30144 WP_000607087.1.3196 WP_000607087.1.37661 WP_000607087.1.4453 WP_000607087.1.46586 WP_000607087.1.474 WP_000607087.1.499 WP_000607087.1.54419 WP_000607087.1.55893 WP_000607087.1.5841 WP_000607087.1.64770 WP_000607087.1.66535 WP_000607087.1.70209 WP_000607087.1.75358 WP_000607087.1.75374 WP_000607087.1.84323 WP_000607087.1.86041 WP_000607087.1.89698 WP_000607087.1.93904 WP_000607087.1.94270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]