SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M1KD04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M1KD04
Domain Number 1 Region: 38-207
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 4.97e-38
Family Chemotaxis phosphatase CheZ 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M1KD04
Sequence length 208
Comment (tr|A0A0M1KD04|A0A0M1KD04_9XANT) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=347 OS=Xanthomonas oryzae. GN=ADT26_11805 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MNATVESDAERAALIERLQGALDALESGDQVAWRREVDHLAALRTRPMMQSLSRLARELG
QALGELPTVPEEAGELDDACSRLDHVVEMTEKASHRTLDLVEECRELANQLRDGGLNQDQ
GALLEKMRHNLTELSLAQSYQDLSGQIIRRVAGIVRRVHEGFGALGLPPKNIEPKKNDGG
LAGPAIKGLDRHAVSQDDADDLLSGLGL
Download sequence
Identical sequences A0A0M1KD04 A0A0U3ALX0
WP_024743927.1.1619 WP_024743927.1.34220 WP_024743927.1.89482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]