SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M1NG83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M1NG83
Domain Number 1 Region: 146-204
Classification Level Classification E-value
Superfamily R3H domain 0.000000000353
Family R3H domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M1NG83
Sequence length 206
Comment (tr|A0A0M1NG83|A0A0M1NG83_9BACI) Protein jag {ECO:0000313|EMBL:KOR81258.1} KW=Complete proteome OX=1581030 OS=Bacillus sp. FJAT-21352. GN=AM232_24605 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKKVTATGQSVEEAVNLALAQLNSTKDRVEIEVEDEGKKGFFGLFGARKAIVHVTLPPDP
IEETLGFLKNVCVEMGVNAQINVTRKGKNVTFHLSGDKIALLIGKRGQTLNSLQYLAQLV
ANRYSKQFLNITVDAEDYRSRRNDTLIQLAERMANKATKTGKAVSLEPMPSYERKVIHNA
LLDYPKIKTTSSGTEPYRHLVITPLK
Download sequence
Identical sequences A0A0M1NG83 A0A0M1NT84 A0A2H3M228
WP_034316177.1.49042 WP_034316177.1.73981 WP_034316177.1.77518 WP_034316177.1.95874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]