SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M1UL77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M1UL77
Domain Number 1 Region: 224-335
Classification Level Classification E-value
Superfamily OmpA-like 3.92e-36
Family OmpA-like 0.00052
Further Details:      
 
Domain Number 2 Region: 35-176
Classification Level Classification E-value
Superfamily OMPA-like 9.94e-16
Family Outer membrane protein 0.006
Further Details:      
 
Domain Number 3 Region: 194-228
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000837
Family TSP type-3 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M1UL77
Sequence length 338
Comment (tr|A0A0M1UL77|A0A0M1UL77_9PROT) Outer membrane fibronectin-binding protein {ECO:0000313|EMBL:BAK70174.1} KW=Complete proteome OX=944546 OS=Arcobacter butzleri ED-1. GN=ABED_0457 OC=Campylobacteraceae; Arcobacter.
Sequence
MKKVLLSTIACASLALAANSDYKYEITPLIGGVLTEGNTGLEKNYANAGLSFGFNQFDSF
IDQVELGFLRTLEDVDGKGNFSNRDTGVTRVFANLVKDYDLTSDLSLYTLVGAGVEFFDN
EFEDNKNGLFGNYGVGVKYNLAERLALKFDVRHLIEVDHGDNTLLYTVGLSVPFGEVSKP
APVAEKPAPVATPVAAPKDSDGDGVIDSLDECPNTMKGAKVDNIGCMTLVNLNINFDTAK
ADIKDSYNSRINEFAKVMKADPKLKANIEAHTDSVGTDAYNQKLSERRATSAVNALVAAG
VQKDRIKAVGYGESRPIASNDTVEGRAENRRVEAVMVK
Download sequence
Identical sequences A0A0M1UL77
WP_014468243.1.18541 WP_014468243.1.45995 WP_014468243.1.66573 gi|384155169|ref|YP_005537984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]