SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M1UML0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M1UML0
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.00000017
Family Chemotaxis phosphatase CheZ 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M1UML0
Sequence length 117
Comment (tr|A0A0M1UML0|A0A0M1UML0_9PROT) Uncharacterized protein {ECO:0000313|EMBL:BAK70407.1} KW=Complete proteome OX=944546 OS=Arcobacter butzleri ED-1. GN=ABED_0690 OC=Campylobacteraceae; Arcobacter.
Sequence
MKYEELITQLCEVIKESENDAEQIFSNTEDIAGIIEDLEIPLYKREKITTLISNIYGSLQ
HQDLYRQKIERVVNYVCEKNDIDKSQYNLAPSAKTIDKTEDSLSDEELEALIKQMQD
Download sequence
Identical sequences A0A0M1UML0
gi|384155402|ref|YP_005538217.1| WP_014468429.1.18541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]