SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M1W413 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M1W413
Domain Number - Region: 38-69
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 0.0119
Family T-antigen specific domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M1W413
Sequence length 100
Comment (tr|A0A0M1W413|A0A0M1W413_9BACE) Uncharacterized protein {ECO:0000313|EMBL:EEO61580.2} KW=Complete proteome OX=457395 OS=Bacteroides sp. 9_1_42FAA. GN=BSBG_02552 OC=Bacteroides.
Sequence
MVKLVHHEMPVNKTLHHRKIEILAVLTLLIGSLSFLIYSYCSHDANNPLCRCLLCTLNHT
PEDGEYLYNRYLVVISITWAALIFGTLFVILYHIERKKKK
Download sequence
Identical sequences A0A076IQ89 A0A0M1W413 C3RFM0 I9FZT9
WP_007844761.1.1104 WP_007844761.1.12058 WP_007844761.1.2685 WP_007844761.1.65375 WP_007844761.1.76205 WP_007844761.1.94919 WP_007844761.1.95664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]