SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2GX25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2GX25
Domain Number 1 Region: 124-169
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000765
Family R3H domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M2GX25
Sequence length 170
Comment (tr|A0A0M2GX25|A0A0M2GX25_9ACTN) Single-stranded DNA-binding protein {ECO:0000313|EMBL:KJK40198.1} KW=Complete proteome; Reference proteome OX=284040 OS=Streptomyces variegatus. GN=UK15_07525 OC=Streptomyces.
Sequence
MTEGTTSAAAEGADTLTRLEQEGEIAADYLEGLLDIADLDGDIDMDVEADRASVSIISDT
GGRDLQKLVGRDGEVLEALQELTRLAVHRETGDRSRLMLDIAGYRAQKRSELSELGAKAA
AEAKSSGEAVKLQPMTPFERKVVHDAVKAAGLRSESEGEEPQRFVVVLPA
Download sequence
Identical sequences A0A0M2GX25
WP_031137666.1.13452 WP_031137666.1.77011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]