SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2KH85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M2KH85
Domain Number - Region: 48-103
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0051
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M2KH85
Sequence length 113
Comment (tr|A0A0M2KH85|A0A0M2KH85_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KKF36331.1} KW=Complete proteome; Reference proteome OX=65700 OS=Erwinia tracheiphila. GN=SY86_14215 OC=Erwiniaceae; Erwinia.
Sequence
MNHPRPAWRYITCIPGITGLLLLATLSTTVQAAEKDELASAQRQLDQVQASLERARVAAA
QADPAEQGRFFFDYRQATSDLNTIRAGIDRYLEPSRSQPRASSVSGNYRRERP
Download sequence
Identical sequences A0A0M2KH85
WP_016190711.1.116 WP_016190711.1.53624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]