SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2X3J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2X3J3
Domain Number 1 Region: 10-68
Classification Level Classification E-value
Superfamily WGR domain-like 0.000000000418
Family WGR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M2X3J3
Sequence length 144
Comment (tr|A0A0M2X3J3|A0A0M2X3J3_9LEPT) Leucine rich repeat protein {ECO:0000313|EMBL:KKO68485.1} KW=Complete proteome OX=28183 OS=Leptospira santarosai. GN=XB16_1836 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKKYLTYQDESSNKFWSVDVSGNTFTVTFGKVGSSGQSSVKTFHDEQECLKEAEKLLREK
LKKGYLETEWPEQKAEAVIKFLSDSFHQFLKTKVKDFEESKYAKAFQKINWEKEADQVFQ
SVCSYWTKSGSQNCLYFGMVIIYL
Download sequence
Identical sequences A0A0M2X3J3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]