SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3CB20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M3CB20
Domain Number - Region: 6-71
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.00837
Family Gametocyte protein Pfg27 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3CB20
Sequence length 82
Comment (tr|A0A0M3CB20|A0A0M3CB20_9SPHI) Uncharacterized protein {ECO:0000313|EMBL:KKX48354.1} KW=Complete proteome; Reference proteome OX=1338009 OS=Sphingobacterium sp. IITKGP-BTPF85. GN=L950_0221620 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MEEILKEKQRVFKEIEKYIGKEKYNFIDLVTEIKDVVDNKDVEGLDIKKLKEYFKIISRN
EENIDLAIDVYMLIEKLKGLKK
Download sequence
Identical sequences A0A0M3CB20
WP_021190610.1.10943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]