SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3CKZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3CKZ4
Domain Number 1 Region: 26-158
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 4.58e-51
Family Ecotin, trypsin inhibitor 0.00000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3CKZ4
Sequence length 160
Comment (tr|A0A0M3CKZ4|A0A0M3CKZ4_PSEPU) Ecotin {ECO:0000256|HAMAP-Rule:MF_00706} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=PU99_26990 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MGSSTISTTVGLIAITLSSIAQAAKLEDVAPFPKPDSGFTRQVIHLAPQAREDDFQVEIL
AGKTLAVDCNRQRLGGILEEKNLEGWGYPFYRLEKVIGPMSTLMACPDGKSTQDFVPVVG
DGFLLRYNSKLPIVLYVPKDIEVRYRIWSASNKVEKAVAE
Download sequence
Identical sequences A0A0M3CKZ4
WP_046819996.1.12382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]