SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3E1K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3E1K7
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 1.11e-29
Family YccV-like 0.00000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3E1K7
Sequence length 105
Comment (tr|A0A0M3E1K7|A0A0M3E1K7_VIBPH) Heat shock protein HspQ {ECO:0000256|HAMAP-Rule:MF_01194, ECO:0000256|SAAS:SAAS00634478} KW=Complete proteome OX=670 OS=Vibrio parahaemolyticus. GN=AAY51_18265 OC=Vibrionaceae; Vibrio.
Sequence
MIASKFGIGQQVRHSLLGYLGVVVDIDPVYSLAEPSPDELAVNDELRAAPWYHVVMEDDD
GRPVHTYLAEAQLSSETQDEHPEQPSMDELAQTIRKQLQAPRLRN
Download sequence
Identical sequences A0A083Z7T1 A0A0F6REE6 A0A0M3E1K7 A0A1I0ZKC5 A0A212HRY6 A0A212HT57 A0A223JPW4
2035987102 WP_042319966.1.100954 WP_042319966.1.101171 WP_042319966.1.12964 WP_042319966.1.13339 WP_042319966.1.22695 WP_042319966.1.29943 WP_042319966.1.31643 WP_042319966.1.37092 WP_042319966.1.40441 WP_042319966.1.4055 WP_042319966.1.4120 WP_042319966.1.41798 WP_042319966.1.51150 WP_042319966.1.53731 WP_042319966.1.70957 WP_042319966.1.83150 WP_042319966.1.86611 WP_042319966.1.99058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]