SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3I8V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3I8V9
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000765
Family First domain of FERM 0.01
Further Details:      
 
Domain Number 2 Region: 130-182
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000183
Family Second domain of FERM 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3I8V9
Sequence length 184
Comment (tr|A0A0M3I8V9|A0A0M3I8V9_ASCLU) Uncharacterized protein {ECO:0000313|WBParaSite:ALUE_0001382701-mRNA-1} KW=Complete proteome; Reference proteome OX=6252 OS=Ascaris lumbricoides (Giant roundworm). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MGIDKVSFAHFALRLIQFPTTHTSNSNDCFWLHGSFTMRHVYEKYFSNSASCSQLRFELR
LRFVPKDLQEMYQIQIDAFMFLHEQVLADYLAQIYKRCIKLKSTHLCFCMNRCSPTIWLR
FELRLRFVPKDLQEMYQIQIDAFMFLHEQVLADYLAQVSWRIPTETAMELASLQLRRRLG
NITV
Download sequence
Identical sequences A0A0M3I8V9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]