SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3J6R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3J6R4
Domain Number 1 Region: 43-108
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000212
Family Tachycitin 0.012
Further Details:      
 
Domain Number 2 Region: 241-294
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000144
Family Tachycitin 0.042
Further Details:      
 
Domain Number 3 Region: 149-207
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000418
Family Tachycitin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3J6R4
Sequence length 318
Comment (tr|A0A0M3J6R4|A0A0M3J6R4_ANISI) Uncharacterized protein {ECO:0000313|WBParaSite:ASIM_0000325401-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
LINVRLFKKDVEVCGGHATSLPVTETTTEVAQEETTASSTPQPTPLPEFSCHSLPDGIYA
QHCSSVFIACSHGRSIPMHCPANLIFDPHLKVCQWKDKVLDCNEVEPTKETPLETTLAPE
IVANVTDDNVIASDTITETIPTTAPSGDSTFSCHGLPDGIYSQGCSKTFALCAAGIETSV
KCPGRLFYDAQFEMCRVKAKIQECMNPATGDLPEPGNDEVTTEHPMLTMTDVIVNSDEPS
LPTEISCVGRPDGMYALGCSTEFVACVAEKVYRMVCPAGLKFEATAKKCLYEVISDQFSV
YSLVHCVDLFELATCTYT
Download sequence
Identical sequences A0A0M3J6R4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]